CYP3A43 Antilichaam - middengebied: HRP (ARP49757 P050-HRP)

Cytochrome P450, family 3, subfamily A, polypeptide 43

MGC119315, MGC119316

64816

Q9HB55

NP_073731

Human, Rat, Cow, Dog, Guinea Pig, Rabbit, Sheep

The immunogen is a synthetic peptide directed towards the middle region of human CYP3A43

CYP3A43 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme has a low level of testosterone hydroxylase activity. Although it bears homology to some drug-metabolizing cytochrome P450s, it is unknown whether the enzyme is also involved in xenobiotic metabolism. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Alternate splicing of this gene results in three transcript variants encoding different isoforms.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme has a low level of testosterone hydroxylase activity. Although it bears homology to some drug-metabolizing cytochrome P450s, it is unknown whether the enzyme is also involved in xenobiotic metabolism. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Alternate splicing of this gene results in three transcript variants encoding different isoforms.

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB, IHC

Affinity Purified

0.5 mg/ml

Cow: 79%; Dog: 79%; Guinea Pig: 79%; Human: 100%; Rabbit: 79%; Rat: 79%; Sheep: 79%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

58kDa

Thompson, E.E., (2006) Pharmacogenomics J. 6 (2), 105-114

Wet Ice

504

CYP3A43

CYP3A43

Rabbit

Cytochrome P450 3A43

NM_022820

ERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIII