CYP3A7 Antilichaam - middengebied: HRP (ARP41801 T100-HRP)

Cytochrome P450, family 3, subfamily A, polypeptide 7

CP37, CYPIIIA7, P450HLp2, P450-HFLA, P-450111A7, P-450 (HFL33)

1551

P24462

NP_000756

Human, Rat, Cow, Dog, Guinea Pig

The immunogen is a synthetic peptide directed towards the middle region of human CYP3A7

CYP3A7 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. The enzyme also metabolizes some drugs such as aflatoxin B1.This gene, CYP3A7, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. The enzyme also metabolizes some drugs such as aflatoxin B1. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Transcript variants have been described, but it is not known whether these transcripts are normally produced.

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

0.5 mg/ml

Cow: 77%; Dog: 75%; Guinea Pig: 83%; Human: 100%; Rat: 85%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

57kDa

Sim, S.C., (2005) Pharmacogenet. Genomics 15 (9), 625-631

Wet Ice

503

CYP3A7

CYP3A7

Rabbit

Cytochrome P450 3A7

NM_000765

KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI