DAAM1 Antilichaam - middelste regio : HRP (ARP55131_P050-HRP)

Dishevelled associated activator of morphogenesis 1

FLJ41657, KIAA0666

23002

Q9Y4D1

NP_055807

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the middle region of human DAAM1

Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton and recent evidence suggests a role for the Formin homology (FH) proteins in these processes. The protein encoded by this gene contains FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. Wnt/Fz signaling activates the small GTPase Rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Activation requires Dvl-Rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein.Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton and recent evidence suggests a role for the Formin homology (FH) proteins in these processes. The protein encoded by this gene contains FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. Wnt/Fz signaling activates the small GTPase Rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Activation requires Dvl-Rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein. Evidence of alternative splicing has been observed for this gene but the full-length nature of these variants has not been determined.

UBC; PRPF40A; B3GALT4; AMBP; MAP3K7; DVL2; DVL1; RHOA

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

123kDa

Higashi, T., (2008) J. Biol. Chem. 283 (13), 8746-8755

Wet Ice

1078

DAAM1

DAAM1

Rabbit

Disheveled-associated activator of morphogenesis 1

NM_014992

GNTVQYWLLLDRIIQQIVIQNDKGQDPDSTPLENFNIKNVVRMLVNENEV