Diervrij SCF, muis

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and are critical for multiple cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates multiple signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members and PLCG1, producing signaling molecules. Animal-Free SCF Protein, Mouse is the recombinant mouse-derived Animal-Free SCF protein, expressed by E. coli, with tag free.

Animal-Free SCF Protein, Mouse, Mouse, E. coli

12352202

KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

17311 (Gene_ID) P20826 (K26-A189) (Accession)

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Room temperature in continental US; may vary elsewhere.

Recombinant Proteins