DKKL1 Antibody - C-terminal regio: FITC (ARP53695 P050-FITC)

Dickkopf-like 1

SGY, CT34, SGY1, SGY-1

27120

Q9UK85

NP_055234

Human, Rat, Dog

The immunogen is a synthetic peptide directed towards the C terminal region of human DKKL1

The dickkopf protein family interacts with the Wnt signaling pathway and its members are characterized by two conserved cysteine-rich domains. DKKL1 is a secreted protein that has high similarity to the N-terminus of the dickkopf-3 protein and moderate similarity to that protein's C-terminus though the C-terminal cysteine residues are not conserved.The dickkopf protein family interacts with the Wnt signaling pathway and its members are characterized by two conserved cysteine-rich domains. This gene encodes a secreted protein that has high similarity to the N-terminus of the dickkopf-3 protein and moderate similarity to that protein's C-terminus though the C-terminal cysteine residues are not conserved.

C11orf71; FJX1; Hoxa1; SCFD1

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Dog: 77%; Human: 100%; Rat: 86%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

27kDa

Olsen, J.V., (2006) Cell 127 (3), 635-648

Wet Ice

242

DKKL1

DKKL1

Rabbit

Dickkopf-like protein 1

NM_014419

DALEGGHWLSEKRHRLQAIRDGLRKGTHKDVLEEGTESSSHSRLSPRKTH