DNAH6 Antilichaam - middengebied: HRP (ARP55679 P050-HRP)

Dynein axonemal heavy chain 6

HL2, HL-2, DNHL1, Dnahc6

1768

Q9C0G6-3

Human

The immunogen is a synthetic peptide directed towards the middle region of Human DYH6

This gene belongs to the dynein family, whose members encode large proteins that are constituents of the microtubule-associated motor protein complex. This complex is composed of dynein heavy, intermediate and light chains, which can be axonemal or cytoplasmic. This protein is an axonemal dynein heavy chain. It is involved in producing force for ciliary beating by using energy from ATP hydrolysis. Mutations in this gene may cause primary ciliary dyskinesia (PCD) as well as heterotaxy.

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity purified

0.5 mg/ml

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

44kDa

Wet Ice

408

DNAH6

DNAH6

Rabbit

Dynein heavy chain 6, axonemal

QIFFKENESLDLQALKLQEPDINFFSEQLEKYHKQHKDAVALRPTRNVGL