DNER Rabbit pAb (APR2219N)

DNER (Delta/Notch-like EGF-related receptor), also known as BET (brain-specific EGF-like transmembrane protein), is a type I transmembrane glycoprotein of the Notch/Delta family . In the mouse, DNER has been detected as 90, 120 and 150 kDa forms which are probably variably glycosylated .Activator of the NOTCH1 pathway. May mediate neuron-glia interaction during astrocytogenesis.DNER associates with protein tyrosine phosphatase zeta (PTP zeta), which is the receptor of pleiotrophin (PTN) . PTP zeta -PTN-DNER signaling has been implicated in the regulation of neuritogenesis. Expression of DNER in glioblastoma stem-like cells inhibits formation of neurospheres in vitro, while in vivo it induces differentiation and inhibits growth of xenografts, thus acting as a tumor suppressor.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DNER Rabbit pAb (APR22117N1) .

DNER; UNQ26; bet

92737

Q8NFT8

Cell membrane, Single-pass type I membrane protein

WB 1:200 - 1:2000 IF 1:50 - 1:200

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 78kDa Observed MW: 80kDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=92737

https://www.uniprot.org/uniprot/Q8NFT8

PATGWTESMAPRQLQPVPATQEPDKILPRSQATVTLPTWQPKTGQKVVEMKWDQVEVIPDIACGNASSNSSAGGRLVSFEVPQNTSVKIRQDATASLILLW