Dnmt1 Antilichaam - N-terminalgebied: FITC (ARP37033_P050-FITC)

DNA methyltransferase (cytosine-5) 1

MTa, Dnmt, MCMT, Met1, Cxxc9, MTase, Met-1, Dnmt1o, MommeD, m.MmuI, MommeD2

13433

P13864

NP_034196

Mouse

The immunogen is a synthetic peptide directed towards the N terminal region of mouse Dnmt1

Dnmt1 methylates CpG residues.Dnmt1 preferentially methylates hemimethylated DNA. Dnmt1 associates with DNA replication sites in S phase maintaining the methylation pattern in the newly synthesized strand, that is essential for epigenetic inheritance.Dnmt1 associates with chromatin during G2 and M phases to maintain DNA methylation independently of replication. It is responsible for maintaining methylation patterns established in development. DNA methylation is coordinated with methylation of histones.Dnmt1 mediates transcriptional repression by direct binding to HDAC2. In association with DNMT3B and via the recruitment of CTCFL/BORIS, Dnmt1 is involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9.

Uhrf1; Parp1; Eed; hist1h3g; DSK2; VPS9; Kat5; Ubc; Atm; NUB1; UBQLN1; SQSTM1; PSMD4; NBR1; RAD23B; Hesx1; Ezh2; Zbtb16; Cul3; Cdh1; Dmap1; Tcf3; hist1h4a; hist1h2bj; hist2h2ab; Dnmt1; Kcnq1ot1; Pla2g2a; Apc; Tox3; Rela; HDAC1

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Mouse: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

183kDa

Wet Ice

1619

DNMT1

Dnmt1

Rabbit

DNA (cytosine-5) -methyltransferase 1

NM_010066

SSVATRRTTRQTTITAHFTKGPTKRKPKEESEEGNSAESAAEERDQDKKR