ELOB-antilichaam - middengebied HRP (ARP31323_P050-HRP)

Elongin B

SIII, TCEB2

6923

Q15370

NP_009039

Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Pig, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the middle region of human TCEB2

This gene encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. Pseudogenes have been identified on chromosomes 11 and 13.

Vif; TCEB1; SOCS4; CUL5; UBC; PRAME; VHL; ASB18; ASB12; ASB14; ASB15; ASB9; ASB8; ASB7; ASB6; ASB5; ASB10; ASB17; ASB16; ASB13; ASB1; ASB3; LRRC47; LARS; EPRS; CDC42; CUL2; ASB2; Zswim8; CSNK1E; NOS2; NEDD8; HIF1A; CFTR; FEM1B; SOCS3; EPAS1; Lrrc41; Wsb1

HRP: Horseradish Peroxidase

Polyclonal Antibody

IHC, WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

13kDa

Van (2007) EMBO J. 26 (15), 3570-3580

Wet Ice

118

ELOB

ELOB

Rabbit

Elongin-B

NM_007108

TARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQ