ERCC1 Antibody - N-terminal regio : HRP (ARP55941_P050-HRP)

Excision repair cross-complementation group 1

UV20, COFS4, RAD10

2067

P07992

NP_001159521.1

Human, Mouse, Rat, Dog, Guinea Pig, Rabbit

The immunogen is a synthetic peptide directed towards the N-terminal region of human ERCC1

The product of this gene functions in the nucleotide excision repair pathway, and is required for the repair of DNA lesions such as those induced by UV light or formed by electrophilic compounds including cisplatin. The encoded protein forms a heterodimer with the XPF endonuclease (also known as ERCC4), and the heterodimeric endonuclease catalyzes the 5' incision in the process of excising the DNA lesion. The heterodimeric endonuclease is also involved in recombinational DNA repair and in the repair of inter-strand crosslinks. Mutations in this gene result in cerebrooculofacioskeletal syndrome, and polymorphisms that alter expression of this gene may play a role in carcinogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. The last exon of this gene overlaps with the CD3e molecule, epsilon associated protein gene on the opposite strand.

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Dog: 86%; Guinea Pig: 79%; Human: 100%; Mouse: 85%; Rabbit: 79%; Rat: 79%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

23kDa

Wet Ice

213

ERCC1

ERCC1

Rabbit

DNA excision repair protein ERCC-1

NM_001166049.1

TVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAK