Estrra Antibody - C-terminal regio : HRP (ARP32259_P050-HRP)

Estrogen related receptor, alpha

Er, Es, Nr3, Err1, Nr3b1, Estrra, ERRalpha

26379

O08580

NP_031979

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse

The immunogen is a synthetic peptide corresponding to a region of Mouse

Esrra binds to an ERR-alpha response element (ERRE) containing a single consensus half-site, 5'-TNAAGGTCA-3'. It can bind to the medium-chain acyl coenzyme A dehydrogenase (MCAD) response element NRRE-1 and may act as an important regulator of MCAD promoter. It binds to the C1 region of the lactoferrin gene promoter. It requires dimerization and the coactivator, PGC-1A, for full activity. The ERRalpha/PGC1alpha complex is a regulator of energy metabolism.

Ubc; Sirt1; Hdac8; Kat2b; Crebzf; Esrrb; Ppargc1a

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

45kDa

Wet Ice

422

ESRRA

Esrra

Rabbit

Steroid hormone receptor ERR1

NM_007953

AGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKL