F7 Antilichaam - C-terminalgebied: FITC (ARP60038 P050-FITC)

Coagulation factor VII (serum prothrombin conversion accelerator)

SPCA

2155

P08709

NP_000122

Human, Mouse, Dog, Rabbit

The immunogen is a synthetic peptide directed towards the C terminal region of human F7

This gene encodes coagulation factor VII which is a vitamin K-dependent factor essential for hemostasis. This factor circulates in the blood in a zymogen form, and is converted to an active form by either factor IXa, factor Xa, factor XIIa, or thrombin by minor proteolysis. Upon activation of the factor VII, a heavy chain containing a catalytic domain and a light chain containing 2 EGF-like domains are generated, and two chains are held together by a disulfide bond. In the presence of factor III and calcium ions, the activated factor then further activates the coagulation cascade by converting factor IX to factor IXa and/or factor X to factor Xa. Alternative splicing of this gene results in 2 transcripts. Defects in this gene can cause coagulopathy.

FUS; CEP76; CEP250; VCP; RCHY1; ALB; UIMC1; USP49; DMWD; F9; F10; F7; HPN; GGCX; F3

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Dog: 79%; Human: 100%; Mouse: 79%; Rabbit: 79%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

28kDa

Wet Ice

466

F7

F7

Rabbit

Coagulation factor VII

NM_000131

AAHCFDKIKNWRNLIAVLGEHDLSEHDGDEQSRRVAQVIIPSTYVPGTTN