
FAK Rabbit pAb (APR18372N)
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
This gene encodes a cytoplasmic protein tyrosine kinase which is found concentrated in the focal adhesions that form between cells growing in the presence of extracellular matrix constituents. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Activation of this gene may be an important early step in cell growth and intracellular signal transduction pathways triggered in response to certain neural peptides or to cell interactions with the extracellular matrix. Several transcript variants encoding different isoforms have been found for this gene.
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FAK Rabbit pAb (APR18370N5) .
FADK; FAK; FAK1; FRNK; PPP1R71; p125FAK; pp125FAK; PTK2
5747
Q05397
Cell junction, Cell membrane, Cytoplasm, Cytoplasmic side, Nucleus, Peripheral membrane protein, cell cortex, centrosome, cytoskeleton, focal adhesion, microtubule organizing center
WB (Mus musculus, Homo sapiens) IHC (Mus musculus)
WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:100
Liquid
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Calculated MW: 39kDa/48kDa/63kDa/99kDa/114kDa/119kDa/120kDa Observed MW: 125Kda
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5747
https://www.uniprot.org/uniprot/Q05397
TVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIG
Beschrijving
FAK Rabbit pAb (APR18372N) Beschikbaar in 50 µL. Bestel eenvoudig online met snelle levering.
Specificaties
Recent bekeken producten

NP (4-hydroxy-3-nitrophenylacetate)
NP-BSA-03Low – 10 mg
10 mg

NP (4-hydroxy-3-nitrophenylacetate)
NP-BSA-03High – 10 mg
10 mg

ExactaCruz® Pipette Tip Reload System, 50-1250 μl, case
sc-201714
80 Racks/Case

Disc Membrane Hydrophobic PTFE, 0.22μm
CPTB14222
50 PCS

Rat Serum Albumin
CSB-NP000101r-01
1 mg

Denhardt's Solution (50X)
EC-915
50 mL

FKBP4, ID (FK506-binding Protein 4, Peptidyl-prolyl cis-trans Isomerase FKBP4, PPIase FKBP4, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 52kD FK506-binding Protein, 52kD FKBP, FKBP-52, 59kD Immunophilin, FKBP59, p59 Protein, FKBP-4, FKBP52)
MBS623609-01
0.2 mL

West Nile Virus, NS3 Protease (WNV)
MBS603723-01
0.1 mg
Recent gezochte producten

BSA and BGG Stock standards (1 vial each @ 2 mg/ml) for BCA Optima Protein Assay kit
BSA-BGG-1
1 PK

General Bovine Serum Albumin (BSA) ELISA Kit
DL-BSA-Ge-01
48 Tests

General Bovine Serum Albumin (BSA) ELISA Kit
RD-BSA-Ge-01
96 Tests

Heparin
BSA-Hep-01 – 10 mg
10 mg

NP (4-hydroxy-3-nitrophenylacetate)
NP-BSA-03High – 10 mg
10 mg

NP (4-hydroxy-3-nitrophenylacetate)
NP-BSA-03High – 50 mg
50 mg

NP (4-hydroxy-3-nitrophenylacetate)
NP-BSA-03Low – 10 mg
10 mg

NP (4-hydroxy-3-nitrophenylacetate)
NP-BSA-03Low – 50 mg
50 mg
