Fas Ligand, mens (HEK293, zijn)

Fas Ligand (CD178; APTL) is a ligand to TNFRSF6/FAS/CD95, transduces the apoptotic signal to regulate cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis and in T-cell development[1]. Human Fas Ligand exhibits 4 isoforms, the soluble form (130-281 a.a.) of which plays an important role in the activation-induced cell death (AICD) of T lymphocytes Jurkat cells[3]. However the membrane-bound isoform could be responsible for its inflammatory activity[4]. Fas Ligand Protein, Human (HEK293, His) has a total length of 148 amino acids (P134-L281), is expressed in HEK392 cells with N-terminal 6*His-tag.

Fas Ligand Protein, Human (HEK293, N-His), Human, HEK293

12352202

95.00

PSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

356 (Gene_ID) P48023-1 (P134-L281) (Accession)

Approximately 23-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Room temperature in continental US; may vary elsewhere.

Stored at -20°C for 2 years

Recombinant Proteins