Fbxo32 Antilichaam - C-terminal regio : FITC (ARP52866_P050-FITC)

F-box protein 32

ATR, MAFb, atro, MAFbx, Gm20361, AI430017, ATROGIN1, 4833442G10Rik

67731

Q9CPU7

NP_080622

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide corresponding to a region from the human protein.

Fbxo32 is a substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. It probably recognizes and binds to phosphorylated target proteins during skeletal muscle atrophy.

Nfkbia; Myod1; Telo2; 9130011E15Rik; Prdm16; Ube2v2; Taf15; Inf2; Sync; Rps13; Tubb6; Fbxo32; Rplp2; Eef1g; Rpl14; Cand2; Srp72; Ube2v1; Ahnak; Eif3f; Atp5d; Srsf4; Adrm1; Mettl3; Pgam2; Eef1b2; Ubqln2; Ywhab; Clpp; Hnrnpa2b1; Mybph; Thop1; Eif3b; Cul1; C

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 92%; Zebrafish: 92%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

39kDa

Wet Ice

355

FBXO32

Fbxo32

Rabbit

F-box only protein 32

NM_026346

LVRCYPRREQYGVTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDF