FBXO36 Antilichaam - N-terminalgebied: FITC (ARP53299_P050-FITC)

F-box protein 36

Fbx36

130888

Q8NEA4

NP_777559

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

The immunogen is a synthetic peptide directed towards the N terminal region of human FBXO36

Members of the F-box protein family, such as FBXO36, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO36, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]) .[supplied by OMIM].

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 85%; Dog: 77%; Guinea Pig: 77%; Horse: 85%; Human: 100%; Mouse: 85%; Pig: 92%; Rabbit: 92%; Rat: 85%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

22kDa

Jin, J., (2004) Genes Dev. 18 (21), 2573-2580

Wet Ice

188

FBXO36

FBXO36

Rabbit

F-box only protein 36

NM_174899

QVIFRWWKISLRSEYRSTKPGEAKETHEDFLENSHLQGQTALIFGARILD