FBXW10 Antilichaam - middengebied: Biotine (ARP52421_P050-Biotine)

F-box and WD repeat domain containing 10

HREP, Fbw10, SM25H2, SM2SH2

10517

Q5XX13

NP_113644

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

The immunogen is a synthetic peptide directed towards the middle region of human FBXW10

Members of the F-box protein family, such as FBXW10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.Members of the F-box protein family, such as FBXW10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]) .[supplied by OMIM].

CUL5

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 93%; Guinea Pig: 77%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 93%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

120kDa

Jin, J., (2004) Genes Dev. 18 (21), 2573-2580

Wet Ice

1051

FBXW10

FBXW10

Rabbit

F-box/WD repeat-containing protein 10

NM_031456

RKIHLLDIIQVKAIPVEFRGHAGSVRALFLCEEENFLLSGSYDLSIRYWD