FEM1B Antilichaam - middelste regio : HRP (ARP53702 P050-HRP)

Fem-1 homolog b (C. elegans)

F1AA, F1A-ALPHA, FEM1-beta

10116

Q9UK73

NP_056137

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

The immunogen is a synthetic peptide directed towards the middle region of human FEM1B

FEM1B is a component of an E3 ubiquitin-protein ligase complex, in which it may act as a substrate recognition subunit. It involved in apoptosis by acting as a death receptor-associated protein that mediates apoptosis. FEM1B also involved in glucose homeostasis in pancreatic islet.

GLI1; HIF1AN; NKX3-1; fem-2; Ppm1f; UBC; RBX1; CUL2; TCEB2; TCEB1; Tnfrsf1a; Fem1b; Fas; Casp3; COPS4; RAD9A; CHEK1; DCUN1D1; COPS5; COPS6; CUL5; NEDD8; KIAA0319; GNB2L1; APAF1

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

FEM1B is strongly supported by BioGPS gene expression data to be expressed in 721_B, HEK293T

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

69kDa

Kamura, T., (2004) Genes Dev. 18 (24), 3055-3065

Wet Ice

627

FEM1B

FEM1B

Rabbit

Protein fem-1 homolog B

NM_015322

FQDGDNILEKEVLPPIHAYGNRTECRNPQELESIRQDRDALHMEGLIVRE