FER1L3 Antilichaam - C-terminalgebied: FITC (ARP46953 P050-FITC)

Myoferlin

FER1L3

26509

Q9NZM1

NP_038479

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the C terminal region of human FER1L3

Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. FER1L3 is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. The protein encoded by this gene is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. Two transcript variants encoding different isoforms have been found for this gene. Other possible variants have been detected, but their full-length natures have not been determined.

UBC; SUMO2; SUMO3; RPA3; RPA2; RPA1; MATR3; ILF2; ATP6V1B1; CDK2; Kdr; Dnm2; ISG15; SUMO1

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

MYOF is strongly supported by BioGPS gene expression data to be expressed in 721_B, HeLa, MCF7

0.5 mg/ml

Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 79%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

235kDa

Patel, P., (2008) J. Mol. Biol. 379 (5), 981-990

Wet Ice

2061

MYOF

MYOF

Rabbit

Myoferlin

NM_013451

QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDM