Fibronectin Rabbit pAb (APR27440N)
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
This gene encodes fibronectin, a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. The encoded preproprotein is proteolytically processed to generate the mature protein. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis. The gene has three regions subject to alternative splicing, with the potential to produce 20 different transcript variants, at least one of which encodes an isoform that undergoes proteolytic processing. The full-length nature of some variants has not been determined.
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Fibronectin Rabbit pAb (APR27440N) .
FN1; CIG; ED-B; FINC; FN; FNZ; GFND; GFND2; LETS; MSF; fibronectin
2335
P02751
Secreted, extracellular matrix, extracellular space
IF (Homo sapiens) WB (Rattus norvegicus, Mus musculus)
WB 1:500 - 1:2000 IHC 1:50 - 1:200
Liquid
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Calculated MW: 71-73kDa/221-272kDa Observed MW: 290kDa
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2335
https://www.uniprot.org/uniprot/P02751
MLRGPGPGLLLLAVQCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQINQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGA
Beschrijving
Fibronectin Rabbit pAb (APR27440N) Beschikbaar in 50 µL. Bestel eenvoudig online met snelle levering.
Specificaties
Recent bekeken producten
Denhardt's Solution (50X)
EC-915
50 mL
FKBP4, ID (FK506-binding Protein 4, Peptidyl-prolyl cis-trans Isomerase FKBP4, PPIase FKBP4, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 52kD FK506-binding Protein, 52kD FKBP, FKBP-52, 59kD Immunophilin, FKBP59, p59 Protein, FKBP-4, FKBP52)
MBS623609-01
0.2 mL
West Nile Virus, NS3 Protease (WNV)
MBS603723-01
0.1 mg
Human Sertoli Cell Complete Medium
MBS2576755-01
100 mL
Urobilinogen protein
MBS5303823-01
100 mg
AffiniPure Goat Anti-Rabbit IgG H&L, HRP conjugated
GTR17765564-01
100 µL
Pribolab® Automatic Immunoaffinity Column Purification System
HWEQ-IM 5050
1 Unit
OneTaq Hot Start 2X Master Mix with GC Buffer
NEB M0485L
500 Reactions
Recent gezochte producten
FKBP4, ID (FK506-binding Protein 4, Peptidyl-prolyl cis-trans Isomerase FKBP4, PPIase FKBP4, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 52kD FK506-binding Protein, 52kD FKBP, FKBP-52, 59kD Immunophilin, FKBP59, p59 Protein, FKBP-4, FKBP52)
MBS623609-01
0.2 mL
VDAC3 (Voltage-dependent Anion-selective Channel Protein 3, VDAC-3, hVDAC3, Outer Mitochondrial Membrane Protein Porin 3) (MaxLight 750)
MBS6236090-01
0.1 mL
Vascular Endothelial Growth Factor A (VEGFA, VEGF-A, VEGF, Vascular Permeability Factor, VPF, MVCD1) (MaxLight 750)
MBS6236092-01
0.1 mL
Vascular Endothelial Growth Factor B (VEGFB, VEGF-B, VEGF-related Factor, VRF, VEGFL) (MaxLight 750)
MBS6236093-01
0.1 mL
VGFR3 (FLT4, VEGFR3, Vascular endothelial growth factor receptor 3, Fms-like tyrosine kinase 4, Tyrosine-protein kinase receptor FLT4) (MaxLight 750)
MBS6236094-01
0.1 mL
VGLL1 (Transcription Cofactor Vestigial-like Protein 1, VGL1, Vgl-1, Protein TONDU, TDU) (MaxLight 750)
MBS6236095-01
0.1 mL
VHL (Von Hippel-Lindau Disease Tumor Suppressor, pVHL, Protein G7, HRCA1, RCA1, VHL1) (MaxLight 750)
MBS6236096-01
0.1 mL
Villin-1 (VIL1, VIL, D2S1471) (MaxLight 750)
MBS6236097-01
0.1 mL