FKBP4 Antilichaam - C-terminaal gebied: Biotine (ARP30180 P050-Biotine)

FK506 binding protein 4, 59kDa

HBI, p52, Hsp56, FKBP51, FKBP52, FKBP59, PPIase

2288

P30416

NP_002005

Human, Pig

The immunogen is a synthetic peptide directed towards the C terminal region of human FKBP4

FKBP4 is a component of unactivated mammalian steroid receptor complexes that sediment at 8-10 S. It may have a rotamase activity. FKBP4 may play a role in the intracellular trafficking of heterooligomeric forms of steroid hormone receptors.The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It has high structural and functional similarity to FK506-binding protein 1A (FKBP1A), but unlike FKBP1A, this protein does not have immunosuppressant activity when complexed with FK506. It interacts with interferon regulatory factor-4 and plays an important role in immunoregulatory gene expression in B and T lymphocytes. This encoded protein is known to associate with phytanoyl-CoA alpha-hydroxylase. It can also associate with two heat shock proteins (hsp90 and hsp70) and thus may play a role in the intracellular trafficking of hetero-oligomeric forms of the steroid hormone receptors. This protein correlates strongly with adeno-associated virus type 2 vectors (AAV) resulting in a significant increase in AAV-mediated transgene expression in human cell lines. Thus this encoded protein is thought to have important implications for the optimal use of AAV vectors in human gene therapy. This gene has been found to have multiple polyadenylation sites. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

HSP90AB1; HSP90AA1; RPS10-NUDT3; CDC37L1; LSM7; CACYBP; CHORDC1; GLMN; CDC37; SUGT1; USP19; PTGES3; AHSA1; UBC; MDM2; MGEA5; TPM3; MCM4; MCM3; SQSTM1; Nr3c1; S100A6; S100A2; S100A1; gag-pol; VCAM1; TAF9; SNCA; SARDH; UBD; PGR; NR3C2; AR; CDK2; SIRT7; SH3B

Biotin

Polyclonal Antibody

WB, IHC

Affinity Purified

FKBP4 is strongly supported by BioGPS gene expression data to be expressed in 721_B

0.5 mg/ml

Human: 100%; Pig: 75%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

52kDa

Ruan, B., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (1), 33-38

Wet Ice

459

FKBP4

FKBP4

Rabbit

Peptidyl-prolyl cis-trans isomerase FKBP4

NM_002014

ANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVETEA