Foxa3 Antilichaam - C-terminaal gebied: Biotine (ARP36881 P050-Biotine)

Forkhead box A3

Hnf3, Hnf-3, Hnf3g, Tcf3g, Hnf-3g, Tcf-3g

15377

P35584

NP_032286

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig

The immunogen is a synthetic peptide directed towards the c terminal region of mouse Foxa3

Foxa3 is a transcription factor that is thought to act as a 'pioneer' factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sites. Foxa3 is originally described as a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc. Foxa3 interacts with the cis-acting regulatory regions of these genes.Foxa3 is involved in glucose homeostasis; activates GLUT2 transcription and regulation of neuronal-specific transcription. Foxa3 is also involved in regulation of spermatogenesis; required for the maintenance of the testicular germ cell population and male fertility.

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 86%; Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 86%; Mouse: 100%; Pig: 86%; Rat: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

37kDa

Wet Ice

353

FOXA3

Foxa3

Rabbit

Hepatocyte nuclear factor 3-gamma

NM_008260

YNFNHPFSINNLMSEQTSTPSKLDVGFGGYGAESGEPGVYYQSLYSRSLL