FZD10 Antilichaam - N-terminaal gebied: Biotine (ARP41262 P050-Biotine)

Frizzled family receptor 10

Fz10, FzE7, CD350, FZ-10, hFz10

11211

Q9ULW2

NP_009128

Human, Mouse, Cow, Dog, Horse, Pig, Zebrafish

The immunogen is a synthetic peptide directed towards the N terminal region of human FZD10

FZD10 is a member of the frizzled family. Members of this family are 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.This gene is a member of the frizzled gene family. Members of this family encode 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Zebrafish: 79%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

65kDa

Omoto, S., (2004) Ophthalmic Genet. 25 (2), 81-90

Wet Ice

581

FZD10

FZD10

Rabbit

Frizzled-10

NM_007197

PIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRF