GABRE Antilichaam - middelste regio : HRP (ARP35342_P050-HRP)

Gamma-aminobutyric acid (GABA) A receptor, epsilon

2564

NP_068819

Human, Mouse, Rat, Guinea Pig, Rabbit

The immunogen is a synthetic peptide directed towards the middle region of human GABRE

GABRE belongs to the ligand-gated ionic channel (TC 1.A.9) family. It encodes the gamma-aminobutyric acid (GABA) A receptor which is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes an epsilon subunit. It is mapped to chromosome Xq28 in a cluster comprised of genes encoding alpha 3, beta 4 and theta subunits of the same receptor. Alternatively spliced transcript variants encoding different isoforms have been identified.

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Guinea Pig: 79%; Human: 100%; Mouse: 85%; Rabbit: 86%; Rat: 92%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

43kDa

Sinkkonen, S.T., et al., (2000) J. Neurosci. 20 (10), 3588-3595

Wet Ice

393

GABRE

GABRE

Rabbit

NM_021984

KNSWKLFQFDFTGVSNKTEIITTPVGDFMVMTIFFNVSRRFGYVAFQNYV

Epsilon