GGCX Antilichaam - middelste regio: FITC (ARP44340_P050-FITC)

Gamma-glutamyl carboxylase

VKCFD1

2677

P38435

NP_000812

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep

The immunogen is a synthetic peptide directed towards the middle region of human GGCX

GGCX is an enzyme which catalyzes the posttranslational modification of vitamin K-dependent protein. Many of these vitamin K-dependent proteins are involved in coagulation so the function of the encoded enzyme is essential for hemostasis. Mutations in this gene are associated with vitamin K-dependent coagulation defect and PXE-like disorder with multiple coagulation factor deficiency.Gamma-glutamyl carboxylase accomplishes the posttranslational modification required for the activity of all of the vitamin K-dependent proteins (Wu et al., 1991 [PubMed 1749935]) . These include some of the blood coagulation and anticoagulation proteins as well as bone gamma-carboxyglutamic acid (Gla) protein (BGLAP; MIM 112260) and bone matrix protein (MGP; MIM 154870) .[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

UBC; DCP2; FBXO6; F9; F10; F7; F2; PROC; BGLAP

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

IHC, WB

Affinity Purified

GGCX is strongly supported by BioGPS gene expression data to be expressed in Jurkat, MCF7

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

87kDa

Rieder, M.J., (2007) J. Thromb. Haemost. 5 (11), 2227-2234

Wet Ice

758

GGCX

GGCX

Rabbit

Vitamin K-dependent gamma-carboxylase

NM_000821

FLLRKLYVFRRSFLMTCISLRNLILGRPSLEQLAQEVTYANLRPFEAVGE