GJA4 Antilichaam - middengebied: Biotine (ARP36603 P050-Biotine)

Gap junction protein, alpha 4, 37kDa

CX37

2701

P35212

NP_002051

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep

The immunogen is a synthetic peptide directed towards the middle region of human GJA4

GJA4 is a member of the connexin family. The protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction.This gene encodes a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Biotin

Polyclonal Antibody

IHC, WB

Affinity Purified

GJA4 is strongly supported by BioGPS gene expression data to be expressed in 721_B

0.5 mg/ml

Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 86%; Sheep: 93%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

37kDa

Cepni, I., (2008) Fertil. Steril. 89 (2), 417-420

Wet Ice

333

GJA4

GJA4

Rabbit

Gap junction alpha-4 protein

NM_002060

QKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVA