GJC2 Antilichaam - middengebied: HRP (ARP36621 P050-HRP)

Gap junction protein, gamma 2, 47kDa

Cx47, HLD2, GJA12, SPG44, CX46.6, LMPH1C, LMPHM3, PMLDAR

57165

Q5T442

NP_065168

Human, Rabbit

The immunogen is a synthetic peptide directed towards the middle region of human GJC2

GJC2 is a gap junction protein. Gap junction proteins are members of a large family of homologous connexins and comprise 4 transmembrane, 2 extracellular, and 3 cytoplasmic domains. This gene plays a key role in central myelination and is involved in peripheral myelination in humans. Defects in this gene are the cause of autosomal recessive Pelizaeus-Merzbacher-like disease-1.This gene encodes a gap junction protein. Gap junction proteins are members of a large family of homologous connexins and comprise 4 transmembrane, 2 extracellular, and 3 cytoplasmic domains. This gene plays a key role in central myelination and is involved in peripheral myelination in humans. Defects in this gene are the cause of autosomal recessive Pelizaeus-Merzbacher-like disease-1.

ALB

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB, IHC

Affinity Purified

GJC2 is supported by BioGPS gene expression data to be expressed in HEK293T

0.5 mg/ml

Human: 100%; Rabbit: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

47kDa

Henneke, M., (2008) Neurology 70 (10), 748-754

Wet Ice

439

GJC2

GJC2

Rabbit

Gap junction gamma-2 protein

NM_020435

APASRTGSATSAGTVGEQGRPGTHERPGAKPRAGSEKGSASSRDGKTTVW