GLRX2 Antilichaam - middengebied HRP (ARP57792_P050-HRP)

Glutaredoxin 2

GRX2, CGI-133

51022

Q9NS18

NP_932066

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep

The immunogen is a synthetic peptide directed towards the middle region of human GLRX2

GLRX2 is a glutathione-dependent oxidoreductase that facilitates the maintenance of mitochondrial redox homeostasis upon induction of apoptosis by oxidative stress.GLRX2 is involved in response to hydrogen peroxide and regulation of apoptosis caused by oxidative stress.GLRX2 acts as a very efficient catalyst of monothiol reactions because of its high affinity for protein glutathione-mixed disulfides.GLRX2 can receive electrons not only from glutathione (GSH), but also from thioredoxin reductase supporting both monothiol and dithiol reactions.GLRX2 efficiently catalyzes both glutathionylation and deglutathionylation of mitochondrial complex I, which in turn regulates the superoxide production by the complex. Overexpression of GLRX2 decreases the susceptibility to apoptosis and prevents loss of cardiolipin and cytochrome c release.

BAG3; TXNRD1

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 86%; Sheep: 86%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

18kDa

Wet Ice

164

GLRX2

GLRX2

Rabbit

Glutaredoxin-2, mitochondrial

NM_197962

NVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLH