GNB1L Antilichaam - C-terminalgebied: HRP (ARP41328_T100-HRP)

Guanine nucleotide binding protein (G protein), beta polypeptide 1-like

GY2, FKSG1, WDR14, WDVCF, DGCRK3

54584

Q9BYB4

NP_443730

Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the C terminal region of human GNB1L

GNB1L is a G-protein beta-subunit-like polypeptide which is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 6 WD repeats and is highly expressed in the heart. Therefore, this gene may contribute to the etiology of those disorders.This gene encodes a G-protein beta-subunit-like polypeptide which is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 6 WD repeats and is highly expressed in the heart. The gene maps to the region on chromosome 22q11, which is deleted in DiGeorge syndrome, trisomic in derivative 22 syndrome and tetrasomic in cat-eye syndrome. Therefore, this gene may contribute to the etiology of those disorders.

UBC

HRP: Horseradish Peroxidase

Polyclonal Antibody

IHC, WB

0.5 mg/ml

Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%; Zebrafish: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

36kDa

Collins, J.E., Genome Biol. 5 (10), R84 (2004)

Wet Ice

327

GNB1L

GNB1L

Rabbit

Guanine nucleotide-binding protein subunit beta-like protein 1

NM_053004

RVFHWRTMQPLAVLAFHSAAVQCVAFTADGLLAAGSKDQRISLWSLYPRA

Beta-like protein 1