GOPC Antibody - C-terminal regio : FITC (ARP58936 P050-FITC)

Golgi-associated PDZ and coiled-coil motif containing

CAL, FIG, PIST, GOPC1, dJ94G16.2

57120

Q9HD26

NP_065132

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the C-terminal region of Human GOPC

This gene encodes a Golgi protein with a PDZ domain. The PDZ domain is globular and proteins which contain them bind other proteins through short motifs near the C-termini. Mice which are deficient in the orthologous protein have globozoospermia and are infertile. Multiple transcript variants encoding different isoforms have been found for this gene.

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity purified

0.5 mg/ml

Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

50kDa

Wet Ice

462

GOPC

GOPC

Rabbit

Golgi-associated PDZ and coiled-coil motif-containing protein

QLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRK