GP1BA Antilichaam - middelste regio : HRP (ARP51320_P050-HRP)

Glycoprotein Ib platelet alpha subunit

BSS, GP1B, VWDP, CD42B, GPIbA, BDPLT1, BDPLT3, DBPLT3, GPIbalpha, CD42b-alpha

2811

P07359

NP_000164.5

Human, Rat, Guinea Pig

The immunogen is a synthetic peptide directed towards the middle region of human GP1BA

Glycoprotein Ib (GP Ib) is a platelet surface membrane glycoprotein composed of a heterodimer, an alpha chain and a beta chain, that is linked by disulfide bonds. The Gp Ib functions as a receptor for von Willebrand factor (VWF) . The complete receptor complex includes noncovalent association of the alpha and beta subunits with platelet glycoprotein IX and platelet glycoprotein V. The binding of the GP Ib-IX-V complex to VWF facilitates initial platelet adhesion to vascular subendothelium after vascular injury, and also initiates signaling events within the platelet that lead to enhanced platelet activation, thrombosis, and hemostasis. This gene encodes the alpha subunit. Mutations in this gene result in Bernard-Soulier syndromes and platelet-type von Willebrand disease. The coding region of this gene is known to contain a polymophic variable number tandem repeat (VNTR) domain that is associated with susceptibility to nonarteritic anterior ischemic optic neuropathy.

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Guinea Pig: 86%; Human: 100%; Rat: 79%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

38kDa

Wet Ice

346

GP1BA

GP1BA

Rabbit

Platelet glycoprotein Ib alpha chain

NM_000173.6

TPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGS