GPA33, Cynomolgus (HEK293, Zijne)

The GPA33 protein may play a role in fundamental cellular processes, particularly in intercellular recognition and signaling, suggesting its involvement in intercellular communication. The exact mechanism by which GPA33 functions in these processes remains an area of interest, emphasizing its potential importance in mediating molecular interactions that contribute to cellular responses. GPA33 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived GPA33, expressed by HEK293, with C-His labeled tag. The total length of GPA33 Protein, Cynomolgus (HEK293, His) is 214 a.a..

GPA33 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

12352202

WPVLWTLCAVRVTVNAITVETSQNVLRALHGKSVTLPCTYHTSTSSREGLIQWDKLLFTHTERVVIWQFSNKDYIYGELYKNRVNISSNVEQSDASITIDQLTMADNGTYECSVSLMSDLDGTTKSRVRLLVLLPPSKPECGIEGETIIGNDIQLTCQSKEGSPTPQYSWKRYDILNQEQPLAQPASGQPVSLKNVSTDTSGYYICTSSNEAGI

101867278 (Gene_ID) G7NU40-1 (I38-V251) (Accession)

Approximately 35-38 kDa & 40-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Room temperature in continental US; may vary elsewhere.

Recombinant Proteins