
GPX4 Rabbit pAb (APR19902N)
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of hydrogen peroxide, organic hydroperoxides and lipid hydroperoxides, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme has a high preference for lipid hydroperoxides and protects cells against membrane lipid peroxidation and cell death. It is also required for normal sperm development; thus, it has been identified as a 'moonlighting' protein because of its ability to serve dual functions as a peroxidase, as well as a structural protein in mature spermatozoa. Mutations in this gene are associated with Sedaghatian type of spondylometaphyseal dysplasia (SMDS) . This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been found for this gene.
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GPX4 Rabbit pAb (APR19902N) .
GPX4; GPx-4; GSHPx-4; MCSP; PHGPx; SMDS; snGPx; snPHGPx
2879
P36969
Cytoplasm, Mitochondrion
WB (Homo sapiens, Rattus norvegicus)
WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
Liquid
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Calculated MW: 19kDa/22kDa Observed MW: 22KDa
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2879
https://www.uniprot.org/uniprot/P36969
ASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
Beschrijving
GPX4 Rabbit pAb (APR19902N) Beschikbaar in 50 µL. Bestel eenvoudig online met snelle levering.
Specificaties
Recent bekeken producten

NP (4-hydroxy-3-nitrophenylacetate)
NP-BSA-03Low – 10 mg
10 mg

NP (4-hydroxy-3-nitrophenylacetate)
NP-BSA-03High – 10 mg
10 mg

ExactaCruz® Pipette Tip Reload System, 50-1250 μl, case
sc-201714
80 Racks/Case

Disc Membrane Hydrophobic PTFE, 0.22μm
CPTB14222
50 PCS

Rat Serum Albumin
CSB-NP000101r-01
1 mg

Denhardt's Solution (50X)
EC-915
50 mL

FKBP4, ID (FK506-binding Protein 4, Peptidyl-prolyl cis-trans Isomerase FKBP4, PPIase FKBP4, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 52kD FK506-binding Protein, 52kD FKBP, FKBP-52, 59kD Immunophilin, FKBP59, p59 Protein, FKBP-4, FKBP52)
MBS623609-01
0.2 mL

West Nile Virus, NS3 Protease (WNV)
MBS603723-01
0.1 mg
Recent gezochte producten

BSA and BGG Stock standards (1 vial each @ 2 mg/ml) for BCA Optima Protein Assay kit
BSA-BGG-1
1 PK

General Bovine Serum Albumin (BSA) ELISA Kit
DL-BSA-Ge-01
48 Tests

General Bovine Serum Albumin (BSA) ELISA Kit
RD-BSA-Ge-01
96 Tests

Heparin
BSA-Hep-01 – 10 mg
10 mg

NP (4-hydroxy-3-nitrophenylacetate)
NP-BSA-03High – 10 mg
10 mg

NP (4-hydroxy-3-nitrophenylacetate)
NP-BSA-03High – 50 mg
50 mg

NP (4-hydroxy-3-nitrophenylacetate)
NP-BSA-03Low – 10 mg
10 mg

NP (4-hydroxy-3-nitrophenylacetate)
NP-BSA-03Low – 50 mg
50 mg
