Gria1 Antilichaam - N-terminaal gebied: Biotine (ARP37670_P050-Biotine)

Glutamate receptor, ionotropic, AMPA1 (alpha 1)

Gl, HI, Glr, Glu, Glr1, Glur, Glr-1, GluA1, GluRA, Glur1, HIPA1, GluR-A, Glur-1, gluR-K1, 2900051M01Rik

14799

P23818

NP_001106796

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Gria1 is an ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. In the presence of CACNG4 or CACNG7 or CACNG8, shows resensitization which is characterized by a delayed accumulation of current flux upon continued application of glutamate.

Lrp1; Grin2c; Grin2a; Grin1; Gria2; Eps8; Cacng2; Sqstm1; HOMER2

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

102kDa

Wet Ice

907

GRIA1

Gria1

Rabbit

Glutamate receptor 1

NM_001113325

CGALHVCFITPSFPVDTSNQFVLQLRPELQEALISIIDHYKWQTFVYIYD