GRIK1 Antilichaam - middengebied: Biotine (ARP35007_P050-Biotine)

Glutamate receptor, ionotropic, kainate 1

Glu, GluK, Glur, GluK1, GluK5, Glur5, Glur-5, Glurbe, D16Ium2, D16Ium24, D16Ium24e, Glurbeta1, A830007B11Rik

14805

Q8C825

XP_006522984.1

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the middle region of mouse GRIK1

Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to the kainate family of glutamate receptors, which are composed of four subunits and function as ligand-activated ion channels. The subunit encoded by this gene is subject to RNA editing (CAG->CGG; Q->R) within the second transmembrane domain, which is thought to alter the properties of ion flow. Alternative splicing, resulting in transcript variants encoding different isoforms, has been noted for this gene.

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

64kDa

Wet Ice

589

GRIK1

GRIK1

Rabbit

Glutamate receptor ionotropic, kainate 1

XM_006522921.2

IQTRWKHPSVDNRDLFYINLYPDYAAISRAVLDLVLYYNWKTVTVVYEDS