Groeihormonenantagonist (G119R)

Recombinant ovine GH-22K G119R produced in E. coli is a single, non-glycosylated, polypeptide chain containing 191 amino acids and having a molecular mass of 22 kDa. It is mutated in single amino acid (G119R) according to similar bovine GH mutein described by Chen et al. (1991), Molecular Endocrinology 5:1845–1852.

Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone

443329

P67930

NP_001009315.2

NM_001009315.3

Ovine

AFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEERILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF

It is recommended to reconstitute the lyophilized oGH G119R in 0.4% NaHCO3 or water adjusted to pH 9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar.

< 0.1 ng/µg of protein (< 1EU/µg)

> 98.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel.

OGH G119R acts as antagonist using an in vitro bioassay in PDF-P1 3B9 cells stably transfected with rabbit GH receptors. It is capable of forming a 1:1 complex with the recombinant ovine growth hormone receptor extracellular domain (ECD) and binds to this ECD with affinity similar to the wild type oGH.

191

Lyophilized

Water, pH 9

22.0 kDA

E. coli

ATFPA