H3f3a Antilichaam - N-terminaal gebied: Biotine (ARP60983 P050-Biotine)

H3 histone, family 3A

H3-3, H3.3, H3-3a, H3-3b, H3.3A, EyeLinc14

15078

P84244

NP_032236

Rat, Dog, Pig, Zebrafish

H3f3a is a variant histone H3 which replaces conventional H3 in a wide range of nucleosomes in active genes. H3f3a constitutes the predominant form of histone H3 in non-dividing cells and is incorporated into chromatin independently of DNA synthesis. H3f3a is deposited at sites of nucleosomal displacement throughout transcribed genes, suggesting that it represents an epigenetic imprint of transcriptionally active chromatin. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Kmt2d; Chd5; Setd1a; Kmt2c; Setd1b; Ezh2; Chd1; Cbx3; Uhrf1; Nfkb2; Hdac5; Hdac3; Kdm6b; Nfe2; Aurka; Cbx2; Ehmt2; Cbx5; Aurkb; Cbx6; Bptf; Creb3l4; Ing2; Cbx7; Cbx8; Cbx4; Cd4; Fosb; Rps6ka5; Rps6ka3; Igh-8; Cd79a; Tcrb; Eif2s3x; Kdm5c; Nanog; Kcnq1ot1

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Dog: 100%; Pig: 100%; Rat: 100%; Zebrafish: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

15kDa

Wet Ice

126

H3F3A

H3f3a

Rabbit

Histone H3.3

NM_008210

KSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ