Hdac4 Antilichaam - C-terminal regio : HRP (ARP43602 P050-HRP)

HD4, 4932408F19Rik

208727

Q6NZM9

NP_997108

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Yeast, Zebrafish

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Hdac4

Hdac4 is responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4) . Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in muscle maturation via its interaction with the myocyte enhancer factors such as MEF2A, MEF2C and MEF2D.

Rfxank; Mef2d; Mef2c; Mef2a; Dnajb6; Tnf; Runx2; Myocd; Ppp2ca; Gli2; Creb1; Atm; Ywhab; Ifrd1

HRP: Horseradish Peroxidase

Polyclonal Antibody

CHIP, WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 77%; Human: 100%; Mouse: 86%; Rat: 93%; Yeast: 82%; Zebrafish: 93%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

118kDa

Wet Ice

1076

HDAC4

Hdac4

Rabbit

Histone deacetylase 4

NM_207225

SSTVGHSLIEAQKCEKEEAETVTAMASLSVGVKPAEKRSEEEPMEEEPPL