HLA-E Rabbit pAb (APR20756N)
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
HLA-E belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin) . The heavy chain is anchored in the membrane. HLA-E binds a restricted subset of peptides derived from the leader peptides of other class I molecules. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail.
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HLA-E Rabbit pAb (APR20756N) .
HLA-6.2; QA1; HLA-E; EA1.2; EA2.1
3133
P13747
Membrane, Single-pass type I membrane protein
WB 1:500 - 1:2000
Liquid
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Calculated MW: 40kDa Observed MW: 50kDa
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3133
https://www.uniprot.org/uniprot/P13747
GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDGRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETL
Beschrijving
HLA-E Rabbit pAb (APR20756N) Beschikbaar in 50 µL. Bestel eenvoudig online met snelle levering.
Specificaties
Recent bekeken producten
Denhardt's Solution (50X)
EC-915
50 mL
FKBP4, ID (FK506-binding Protein 4, Peptidyl-prolyl cis-trans Isomerase FKBP4, PPIase FKBP4, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 52kD FK506-binding Protein, 52kD FKBP, FKBP-52, 59kD Immunophilin, FKBP59, p59 Protein, FKBP-4, FKBP52)
MBS623609-01
0.2 mL
West Nile Virus, NS3 Protease (WNV)
MBS603723-01
0.1 mg
Human Sertoli Cell Complete Medium
MBS2576755-01
100 mL
Urobilinogen protein
MBS5303823-01
100 mg
AffiniPure Goat Anti-Rabbit IgG H&L, HRP conjugated
GTR17765564-01
100 µL
Pribolab® Automatic Immunoaffinity Column Purification System
HWEQ-IM 5050
1 Unit
OneTaq Hot Start 2X Master Mix with GC Buffer
NEB M0485L
500 Reactions
Recent gezochte producten
FKBP4, ID (FK506-binding Protein 4, Peptidyl-prolyl cis-trans Isomerase FKBP4, PPIase FKBP4, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 52kD FK506-binding Protein, 52kD FKBP, FKBP-52, 59kD Immunophilin, FKBP59, p59 Protein, FKBP-4, FKBP52)
MBS623609-01
0.2 mL
VDAC3 (Voltage-dependent Anion-selective Channel Protein 3, VDAC-3, hVDAC3, Outer Mitochondrial Membrane Protein Porin 3) (MaxLight 750)
MBS6236090-01
0.1 mL
Vascular Endothelial Growth Factor A (VEGFA, VEGF-A, VEGF, Vascular Permeability Factor, VPF, MVCD1) (MaxLight 750)
MBS6236092-01
0.1 mL
Vascular Endothelial Growth Factor B (VEGFB, VEGF-B, VEGF-related Factor, VRF, VEGFL) (MaxLight 750)
MBS6236093-01
0.1 mL
VGFR3 (FLT4, VEGFR3, Vascular endothelial growth factor receptor 3, Fms-like tyrosine kinase 4, Tyrosine-protein kinase receptor FLT4) (MaxLight 750)
MBS6236094-01
0.1 mL
VGLL1 (Transcription Cofactor Vestigial-like Protein 1, VGL1, Vgl-1, Protein TONDU, TDU) (MaxLight 750)
MBS6236095-01
0.1 mL
VHL (Von Hippel-Lindau Disease Tumor Suppressor, pVHL, Protein G7, HRCA1, RCA1, VHL1) (MaxLight 750)
MBS6236096-01
0.1 mL
Villin-1 (VIL1, VIL, D2S1471) (MaxLight 750)
MBS6236097-01
0.1 mL