
HMGB1 Recombinant eiwit
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
Source : Escherichia Coli. HMG1 Human Recombinant fused with 6X His tag produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 223 amino acids and having a molecular mass of 26 kDa.The HMGB-1 is purified by proprietary chromatographic techniques. High-mobility group box 1 protein (HMGB1), previously known as HMG-1 or amphoterin, is a member of the high mobility group box family of non-histone chromosomal proteins. Human HMGB1 is expressed as a 30 kDa, 215 amino acid (aa) single chain polypeptide containing three domains: two N-terminal globular, 70 aa positively charged DNA-binding domains (HMG boxes A and B), and a negatively charged 30 aa C-terminal region that contains only Asp and Glu.4, 5 Residues 27 - 43 and 178 - 184 contain a NLS. Posttranslational modifications of the molecule have been reported, with acetylation occurring on as many as 17 lysine residues. HMGB1 is expressed at high levels in almost all cells. It was originally discovered as a nuclear protein that could bend DNA. Such bending stabilizes nucleosome formation and regulates the expression of select genes upon recruitment by DNA binding proteins.
HMG1||HMG3||SBP-1||Amphoterin||HMGB1||High-Mobility Group Box 1.
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
The HMG1 (1 mg/mL) was lyophilized after extensive dialyses against 1x PBS pH-7.4.
Lyophilized HMGB1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution HMGB1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.
It is recommended to reconstitute the lyophilized HMGB1 in sterile 18MΩ-cm H2O not less than 100 μg/ml, which can then be further diluted to other aqueous solutions.
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDELEHHHHHH.
Beschrijving
Source : Escherichia Coli. HMG1 Human Recombinant fused with 6X His tag produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 223 amino
Specificaties
Recent bekeken producten

Biotin-Recombinant (sf9) Marburg virus glycoprotein (Musoke, HA-tag, >95%), purified
MVGP16-BTN
100 µL

MARV VP40/Marburg VP40 Protein (N-His, Lake Victoria marburgvirus (strain Musoke-80) (MARV) (Marburg virus (strain Kenya/Musoke/1980) ) )
P505862
100 µg

Hettich Centrifuge Rotanta 460R Refrigerated Large Volume
CEN0703
1 Each

X4RF Refrigerated Centrifuge
75009936
1 Each

Drug Stability Chamber
500-DSC102
1 Unit

Modular Incubator Chamber
MIC-101
1 Unit

CYP707A2 Antibody
GTR17947107
2 mg

SsDNA Assay Kit
12645ES60
100 Tests
