
HRP-geconjugeerde muis anti GST-tag mAb (AMM22037N)
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
Glutathione S-transferases (GSTs), previously known as ligandins, comprise a family of eukaryotic and prokaryotic phase II metabolic isozymes best known for their ability to catalyze the conjugation of the reduced form of glutathione (GSH) to xenobiotic substrates for the purpose of detoxification. The GST family consists of three superfamilies: the cytosolic, mitochondrial, and microsomal—also known as MAPEG—proteins. Members of the GST superfamily are extremely diverse in amino acid sequence, and a large fraction of the sequences deposited in public databases are of unknown function. The Enzyme Function Initiative (EFI) is using GSTs as a model superfamily to identify new GST functions.A GST-tag is often used to separate and purify proteins that contain the GST-fusion protein. The tag is 220 amino acids (roughly 26 KDa) in size, which, compared to tags such as the Myc-tag or the FLAG-tag, is quite large. It can be fused to either the N-terminus or C-terminus of a protein. However, many commercially available sources of GST-tagged plasmids include a thrombin domain for cleavage of the GST tag during protein purification.
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HRP-conjugated Mouse anti GST-Tag mAb (AMM22037N) .
GST; GST tag; GST-tag
WB (Homo sapiens)
WB 1:2000 - 1:10000
Liquid
Buffer: PBS with 50% glycerol, pH7.3.
Calculated MW: 26kDa Observed MW: Refer to Figures
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
Beschrijving
HRP-geconjugeerde muis anti GST-tag mAb (AMM22037N) Beschikbaar in 50 µL. Bestel eenvoudig online met snelle levering.
Specificaties
Recent bekeken producten

ExactaCruz® Pipette Tip Reload System, 50-1250 μl, case
sc-201714
80 Racks/Case

Disc Membrane Hydrophobic PTFE, 0.22μm
CPTB14222
50 PCS

Rat Serum Albumin
CSB-NP000101r-01
1 mg

Denhardt's Solution (50X)
EC-915
50 mL

FKBP4, ID (FK506-binding Protein 4, Peptidyl-prolyl cis-trans Isomerase FKBP4, PPIase FKBP4, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 52kD FK506-binding Protein, 52kD FKBP, FKBP-52, 59kD Immunophilin, FKBP59, p59 Protein, FKBP-4, FKBP52)
MBS623609-01
0.2 mL

West Nile Virus, NS3 Protease (WNV)
MBS603723-01
0.1 mg

Human Sertoli Cell Complete Medium
MBS2576755-01
100 mL

Urobilinogen protein
MBS5303823-01
100 mg
Recent gezochte producten

ExactaCruz® Pipette Tip Reload System, 50-1250 μl, case
sc-201714
80 Racks/Case

Cbp 3'UTR Luciferase Stable Cell Line
TU201714
1.0 mL

Mouse Gpx2 activation kit by CRISPRa
GA201714
1 Kit

CCDC50 Human qPCR Template Standard (NM_174908)
HK201714
1 Kit

Prpsap2 Mouse qPCR Template Standard (NM_144806)
MK201714
1 Kit

Horse Prekallikrein Affinity Purified
B2017141
50 µg

Human Recombinant Activin A
B2017149
10 µg

Mouse Alpha-N-acetyl-neuraminyl-2, 3-beta-galactosyl-1, 3-N-acetyl-galactosaminide alpha-2, 6-sialyltransferase (ST6GALNAC4) ELISA Kit
MBS7201714-01
48 Well
