HS2ST1 Antilichaam - middengebied: FITC (ARP48741 P050-FITC)

Heparan sulfate 2-O-sulfotransferase 1

NFSRA, dJ604K5.2

9653

Q7LGA3

NP_036394

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the middle region of human HS2ST1

Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. HS2ST1 is a member of the heparan sulfate biosynthetic enzyme family that transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. The disruption of this gene resulted in no kidney formation in knockout embryonic mice, indicating that the absence of this enzyme may interfere with the signaling required for kidney formation. Two alternatively spliced transcript variants that encode different proteins have been found for this gene.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. This gene encodes heparan sulfate 2-O-sulfotransferase, a member of the heparan sulfate biosynthetic enzyme family. This family member transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. The disruption of this gene resulted in no kidney formation in knockout embryonic mice, indicating that the absence of this enzyme may interfere with the signaling required for kidney formation.

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

HS2ST1 is strongly supported by BioGPS gene expression data to be expressed in 721_B

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

42kDa

Xu, D., (2007) J. Biol. Chem. 282 (11), 8356-8367

Wet Ice

356

HS2ST1

HS2ST1

Rabbit

Heparan sulfate 2-O-sulfotransferase 1

NM_012262

GVTEELEDFIMLLEAALPRFFRGATELYRTGKKSHLRKTTEKKLPTKQTI