Hsp90aa1 Antilichaam - C-terminal regio : HRP (ARP61231 P050-HRP)

Heat shock protein 90, alpha (cytosolic), class A member 1

Hs, Hsp, hsp4, 86kDa, 89kDa, Hsp89, Hsp90, Hspca, Hsp86-1, AL024080, AL024147

15519

P07901

NP_034610

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish

Hsp90aa1 is a molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Hsp90aa1 undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Hsp90aa1 interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function.

Isg15; Akt1; Eed; Cdk4; Lrrk2; DSK2; E130012A19Rik; Fbxo32; Iqcb1; Nphp4; Chordc1; Nphp1; Ahi1; Itgb1bp2; Krt8; Nod1; Ubc; Cdc37; Traf6; Slc34a1; Slc17a1; Fkbpl

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

85kDa

Wet Ice

733

HSP90AA1

Hsp90aa1

Rabbit

Heat shock protein HSP 90-alpha

NM_010480

STMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALL