HTR3E Antilichaam - middengebied: Biotine (ARP35532_P050-Biotine)

5-hydroxytryptamine (serotonin) receptor 3E, ionotropic

5-HT3E, 5-HT3-E, 5-HT3c1

285242

A5X5Y0

NP_872395

Human, Dog, Horse, Rabbit

The immunogen is a synthetic peptide directed towards the middle region of human HTR3E

HTR3E belongs to the ligand-gated ion channel receptor superfamily. HTR3E is a subunit E of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. Genes encoding subunits C, D and E form a cluster on chromosome 3. The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes a subunit E of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. Genes encoding subunits C, D and E form a cluster on chromosome 3. An alternative splice variant has been described but its full length sequence has not been determined.

Biotin

Polyclonal Antibody

IF, WB

Affinity Purified

0.5 mg/ml

Dog: 100%; Horse: 83%; Human: 100%; Rabbit: 83%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

53kDa

Peters, J.A., Biochem. Soc. Trans. 32 (PT3), 547-552 (2004)

Wet Ice

471

HTR3E

HTR3E

Rabbit

5-hydroxytryptamine receptor 3E

NM_182589

RWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPG