ID4 Antilichaam - middengebied: FITC (ARP32327 P050-FITC)

Inhibitor of DNA binding 4, dominant negative helix-loop-helix protein

IDB4, bHLHb27

3400

P47928

NP_001537

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the middle region of human ID4

Transcription factors containing a basic helix-loop-helix (bHLH) motif regulate expression of tissue-specific genes in a number of mammalian and insect systems. DNA-binding activity of the bHLH proteins is dependent on formation of homo- and/or heterodimers. Dominant-negative HLH proteins encoded by Id-related genes, such as ID4, also contain the HLH-dimerization domain but lack the DNA-binding basic domain. Consequently, Id proteins inhibit binding to DNA and transcriptional transactivation by heterodimerization with bHLH proteins.Transcription factors containing a basic helix-loop-helix (bHLH) motif regulate expression of tissue-specific genes in a number of mammalian and insect systems. DNA-binding activity of the bHLH proteins is dependent on formation of homo- and/or heterodimers. Dominant-negative HLH proteins encoded by Id-related genes, such as ID4, also contain the HLH-dimerization domain but lack the DNA-binding basic domain. Consequently, Id proteins inhibit binding to DNA and transcriptional transactivation by heterodimerization with bHLH proteins (Pagliuca et al., 1995 [PubMed 7665172]) .[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

TCF3; TCF4; ID3; MYOD1; HES1

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

ID4 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

0.5 mg/ml

Cow: 85%; Dog: 100%; Guinea Pig: 85%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 79%; Rat: 100%; Zebrafish: 86%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

16kDa

Russell, L.J., (2008) Blood 111 (1), 387-391

Wet Ice

161

ID4

ID4

Rabbit

DNA-binding protein inhibitor ID-4

NM_001546

CYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP