IFN a 2b Recombinant eiwit

Source : Escherichia Coli. Interferon-a 2b Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 166 amino acids and having a molecular mass of 19400 Dalton.The Interferon-alpha 2b gene was obtained from human leukocytes.The IFN-a 2b is purified by proprietary chromatographic techniques. IFN-alpha is produced by macrophages and has antiviral activities. Interferon stimulates the production of two enzymes: protein kinase and an oligoadenylate synthetase.

Interferon alpha 2b||IFNA||INFA2||MGC125764||MGC125765.

Greater than 98.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Lyophilized from a (1 mg/mL) solution in containing 2.3 mg Sodium phosphate dibasic and 0.55 mg sodium phosphate monobasic buffer.

Lyophilized Interferon although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IFN alpha 2b should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

It is recommended to reconstitute the lyophilized Interferon-alpha 2b in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. The specific activity as determined in a viral resistance assay using bovine kidney MDBK cells was found to be 260,000,000 IU/ mg.

MCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLF STMDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSP CAWEVVRAEIMRSFSLSTNLQESLRSKE.