IFT122 Antilichaam - C-terminalgebied: Biotine (ARP53817_P050-Biotine)

Intraflagellar transport 122 homolog (Chlamydomonas)

CED, SPG, CED1, FAP80, WDR10, WDR10p, WDR140

55764

Q9HBG6

NP_443716

Human

The immunogen is a synthetic peptide directed towards the C terminal region of human IFT122

IFT122 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. IFT122 contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation.This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This cytoplasmic protein contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

UBC; gag-pol

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Human: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

129kDa

Gross, C., (2001) DNA Cell Biol. 20 (1), 41-52

Wet Ice

1131

IFT122

IFT122

Rabbit

Intraflagellar transport protein 122 homolog

NM_052990

QADPAQKDTMLGKFYHFQRLAELYHGYHAIHRHTEDPFSVHRPETLFNIS