IFT122 Antilichaam : HRP (ARP53816_P050-HRP)

Intraflagellar transport 122 homolog (Chlamydomonas)

CED, SPG, CED1, FAP80, WDR10, WDR10p, WDR140

55764

Q9HBG6

NP_443715

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the following sequence EGLDFETAKKAFIRVQDLRYLELISSIEERKKRGETNNDLFLADVFSYQG

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This cytoplasmic protein contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

UBC; gag-pol

HRP: Horseradish Peroxidase

Polyclonal Antibody

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

142 kDa

Wet Ice

1241

IFT122

IFT122

Rabbit

Intraflagellar transport protein 122 homolog

NM_018262

EGLDFETAKKAFIRVQDLRYLELISSIEERKKRGETNNDLFLADVFSYQG