
IL 13 Recombinant eiwit
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
Source : Escherichia Coli. Interleukin-13 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 112 amino acids and having a molecular mass of 12 kDa. The IL-13 is purified by proprietary chromatographic techniques. IL13 is an immunoregulatory cytokine produced primarily by activated Th2 cells. IL-13 is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4.
NC30||ALRH||BHR1||P600||IL-13||MGC116786||MGC116788||MGC116789.
Greater than 95% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
The protein (1mg/mL) was lyophilized with 1xPBS pH-7.2 & 5% trehalose.
Lyophilized Interleukin-13 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL13 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.
It is recommended to reconstitute the lyophilized Interleukin 13 in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. The ED50 was determined by the dose dependent prolifiration of TF-1 cells and was found to be < 1ng/ml, corresponding to a specific activity of >1 x 106units/mg.
GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN.
Beschrijving
Source : Escherichia Coli. Interleukin-13 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 112 amino acids and ha
Specificaties
Recent bekeken producten

Biotin-Recombinant (sf9) Marburg virus glycoprotein (Musoke, HA-tag, >95%), purified
MVGP16-BTN
100 µL

MARV VP40/Marburg VP40 Protein (N-His, Lake Victoria marburgvirus (strain Musoke-80) (MARV) (Marburg virus (strain Kenya/Musoke/1980) ) )
P505862
100 µg

Hettich Centrifuge Rotanta 460R Refrigerated Large Volume
CEN0703
1 Each

X4RF Refrigerated Centrifuge
75009936
1 Each

Drug Stability Chamber
500-DSC102
1 Unit

Modular Incubator Chamber
MIC-101
1 Unit

CYP707A2 Antibody
GTR17947107
2 mg

SsDNA Assay Kit
12645ES60
100 Tests
