IL-36 alfa/IL-1F6, menselijk (158a.a)
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
IL-36 α/IL-1F6 protein binds to IL1RL2/IL-36R receptor, activates NF-kappa-B and MAPK pathways, and induces pro-inflammatory responses. IL-36 α/IL-1F6 also upregulates CD83, CD86, and HLA-DR in dendritic cells, promotes dendritic cell maturation, and drives T cell proliferation. IL-36 alpha/IL-1F6 Protein, Human (158a.a) is the recombinant human-derived IL-36 alpha/IL-1F6 protein, expressed by E. coli , with tag free.
IL-36 alpha/IL-1F6 Protein, Human (158a.a), Human, E. coli
12352202
96.00
MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
27179 (Gene_ID) Q9UHA7 (M1-F158) (Accession)
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
Room temperature in continental US; may vary elsewhere.
Stored at -20°C for 2 years
Recombinant Proteins
Beschrijving
IL-36 α/IL-1F6 protein binds to IL1RL2/IL-36R receptor, activates NF-kappa-B and MAPK pathways, and induces pro-inflammatory responses. IL-36 α/IL-1F6 also upre
